Lineage for d1dw9h2 (1dw9 H:87-156)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564270Fold d.72: Cyanase C-terminal domain [55233] (1 superfamily)
    intertwined dimer of alpha-beta(2) motifs ; 2 layers, alpha/beta
  4. 2564271Superfamily d.72.1: Cyanase C-terminal domain [55234] (2 families) (S)
    automatically mapped to Pfam PF02560
  5. 2564272Family d.72.1.1: Cyanase C-terminal domain [55235] (2 proteins)
    active form is a decamer formed by five dimers
  6. 2564273Protein Cyanase C-terminal domain [55236] (1 species)
  7. 2564274Species Escherichia coli [TaxId:562] [55237] (2 PDB entries)
  8. 2564282Domain d1dw9h2: 1dw9 H:87-156 [39603]
    Other proteins in same PDB: d1dw9a1, d1dw9b1, d1dw9c1, d1dw9d1, d1dw9e1, d1dw9f1, d1dw9g1, d1dw9h1, d1dw9i1, d1dw9j1
    CASP3
    complexed with cl, so4

Details for d1dw9h2

PDB Entry: 1dw9 (more details), 1.65 Å

PDB Description: structure of cyanase reveals that a novel dimeric and decameric arrangement of subunits is required for formation of the enzyme active site
PDB Compounds: (H:) cyanate lyase

SCOPe Domain Sequences for d1dw9h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dw9h2 d.72.1.1 (H:87-156) Cyanase C-terminal domain {Escherichia coli [TaxId: 562]}
riptdptmyrfyemlqvygttlkalvhekfgdgiisainfkldvkkvadpeggeravitl
dgkylptkpf

SCOPe Domain Coordinates for d1dw9h2:

Click to download the PDB-style file with coordinates for d1dw9h2.
(The format of our PDB-style files is described here.)

Timeline for d1dw9h2: