Lineage for d6uwqa_ (6uwq A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2903431Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2903944Protein automated matches [190514] (12 species)
    not a true protein
  7. 2903968Species Mycobacterium ulcerans [TaxId:362242] [395872] (10 PDB entries)
  8. 2903973Domain d6uwqa_: 6uwq A: [395947]
    automated match to d2w3wa_
    complexed with edo, nap, qkj

Details for d6uwqa_

PDB Entry: 6uwq (more details), 1.5 Å

PDB Description: crystal structure of dihydrofolate reductase from mycobacterium ulcerans with sddc-0001565 inhibitor
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d6uwqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6uwqa_ c.71.1.1 (A:) automated matches {Mycobacterium ulcerans [TaxId: 362242]}
svgliwaqstsgvigrdggipwrlpedlahfkrltmghtvvmgrrtwdslpaahrplpgr
rnvvvtrqtglvahgaqvvgsleqalspaepdaatwviggaqiyalalplanrcevtevd
vdlppededalapvldqtwagtsgewlvsrsglryrmhsyrrl

SCOPe Domain Coordinates for d6uwqa_:

Click to download the PDB-style file with coordinates for d6uwqa_.
(The format of our PDB-style files is described here.)

Timeline for d6uwqa_: