Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries) |
Domain d6tnph1: 6tnp H:6-115 [395865] Other proteins in same PDB: d6tnpb2, d6tnpd2, d6tnpf2, d6tnph2, d6tnpi2, d6tnpk2 automated match to d1oauh_ complexed with no8 |
PDB Entry: 6tnp (more details), 3 Å
SCOPe Domain Sequences for d6tnph1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6tnph1 b.1.1.1 (H:6-115) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qsdaelvkpgssvkisckasgytftdhaihwvkqkpeqglewighfspgntdikyndkfk gkatltvdrssstaymqlnsltsedsavyfcktstfffdywgqgttltvs
Timeline for d6tnph1: