Lineage for d6thob1 (6tho B:2-218)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533756Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2533757Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2534628Family d.3.1.14: Phytochelatin synthase [142867] (2 proteins)
    Pfam PF05023; assosiated Pfam PF09328 (DUF1984) is a part of the same functional unit
  6. 2534635Protein automated matches [395700] (1 species)
    not a true protein
  7. 2534636Species Nostoc sp. [TaxId:103690] [395701] (3 PDB entries)
  8. 2534638Domain d6thob1: 6tho B:2-218 [395783]
    Other proteins in same PDB: d6thoa2, d6thob2
    automated match to d2bu3a_
    complexed with ca, gds

Details for d6thob1

PDB Entry: 6tho (more details), 1.09 Å

PDB Description: acylintermediate of glutathione and the mature primitive phytochelatin synthase alr0975 from nostoc pcc 7120 at atomic resolution.
PDB Compounds: (B:) alr0975 protein

SCOPe Domain Sequences for d6thob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6thob1 d.3.1.14 (B:2-218) automated matches {Nostoc sp. [TaxId: 103690]}
qtltlspnligfnsnegekllltsrsredffplsmqfvtqvnqaycgvasiimvlnslgi
napetaqyspyrvftqdnffsnektkaviapevvarqgmtldelgrliasygvkvkvnha
sdtniedfrkqvaenlkqdgnfvivnylrkeigqergghisplaayneqtdrflimdvsr
ykyppvwvkttdlwkamntvdsvsqktrgfvfvsktq

SCOPe Domain Coordinates for d6thob1:

Click to download the PDB-style file with coordinates for d6thob1.
(The format of our PDB-style files is described here.)

Timeline for d6thob1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6thob2