![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.0: automated matches [191311] (1 protein) not a true family |
![]() | Protein automated matches [190052] (8 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186914] (120 PDB entries) |
![]() | Domain d5rz4a3: 5rz4 A:297-390 [395668] Other proteins in same PDB: d5rz4a1, d5rz4a2 automated match to d2he7a3 complexed with dms, edo, wh7 |
PDB Entry: 5rz4 (more details), 1.61 Å
SCOPe Domain Sequences for d5rz4a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5rz4a3 b.55.1.0 (A:297-390) automated matches {Human (Homo sapiens) [TaxId: 9606]} gvdlhhakdsegveimlgvcasglliyrdrlrinrfawpkvlkisykrnnfyikirpgef eqfestigfklpnhraakrlwkvcvehhtffrll
Timeline for d5rz4a3: