SCOPe 2.07: Domain d1dm9b_: 1dm9 B:

Lineage for d1dm9b_ (1dm9 B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
   alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta

4. Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families)
   common motif in otherwise different folds

5. Family d.66.1.3: Heat shock protein 15 kD [55182] (2 proteins)
   there are additional C-terminal structures

6. Protein Heat shock protein 15 kD [55183] (1 species)
   ribosome-binding protein

7. Species Escherichia coli [TaxId:562] [55184] (2 PDB entries)

8. Domain d1dm9b_: 1dm9 B: [39561]
   complexed with so4

Details for d1dm9b_

PDB Entry: 1dm9, 2 Å

PDB Description: heat shock protein 15 kd

PDB Compounds: (B:) hypothetical 15.5 kd protein in mrca-pcka intergenic region

SCOPe Domain Sequences for d1dm9b_:

Sequence; same for both SEQRES and ATOM records:

>d1dm9b_ d.66.1.3 (B:) Heat shock protein 15 kD {Escherichia coli [TaxId: 562]}
kpavevrldkwlwaarfyktralaremieggkvhyngqrskpskivelnatltlrqgnde
rtvivkaiteqrrpaseaallyeetaesvekrekmalarklnaltmp

Timeline for d1dm9b_:

• d1dm9b_ first appeared (with stable ids) in SCOP 1.55
  
• d1dm9b_ appears in SCOPe 2.06
  
• d1dm9b_ appears in the current release, SCOPe 2.08