Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily) alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta |
Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) common motif in otherwise different folds |
Family d.66.1.3: Heat shock protein 15 kD [55182] (1 protein) there are additional C-terminal structures |
Protein Heat shock protein 15 kD [55183] (1 species) ribosome-binding protein |
Species Escherichia coli [TaxId:562] [55184] (2 PDB entries) |
Domain d1dm9a_: 1dm9 A: [39560] complexed with so4 |
PDB Entry: 1dm9 (more details), 2 Å
SCOPe Domain Sequences for d1dm9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dm9a_ d.66.1.3 (A:) Heat shock protein 15 kD {Escherichia coli [TaxId: 562]} pavevrldkwlwaarfyktralaremieggkvhyngqrskpskivelnatltlrqgnder tvivkaiteqrrpaseaallyeetaesvekrekmalarklnalt
Timeline for d1dm9a_: