Lineage for d5s00a1 (5s00 A:107-190)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933161Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries)
  8. 2933222Domain d5s00a1: 5s00 A:107-190 [395575]
    Other proteins in same PDB: d5s00a2, d5s00a3
    automated match to d2he7a1
    complexed with dms, edo, wjm

Details for d5s00a1

PDB Entry: 5s00 (more details), 1.77 Å

PDB Description: epb41l3 pandda analysis group deposition -- crystal structure of the ferm domain of human epb41l3 in complex with z2856434793
PDB Compounds: (A:) Isoform 2 of Band 4.1-like protein 3

SCOPe Domain Sequences for d5s00a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5s00a1 d.15.1.0 (A:107-190) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pksmqckvilldgseytcdvekrsrgqvlfdkvcehlnllekdyfgltyrdaenqknwld
pakeikkqvrsgawhfsfnvkfyp

SCOPe Domain Coordinates for d5s00a1:

Click to download the PDB-style file with coordinates for d5s00a1.
(The format of our PDB-style files is described here.)

Timeline for d5s00a1: