SCOPe 2.08: Domain d1lbua2: 1lbu A:84-213

Lineage for d1lbua2 (1lbu A:84-213)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta

4. Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (5 families)
   zinc-binding motif

5. Family d.65.1.1: Muramoyl-pentapeptide carboxypeptidase [55167] (1 protein)
   automatically mapped to Pfam PF08291

6. Protein Zn2+ DD-carboxypeptidase C-terminal catalytic domain [55168] (1 species)

7. Species Streptomyces albus G [TaxId:1962] [55169] (1 PDB entry)

8. Domain d1lbua2: 1lbu A:84-213 [39549]
   Other proteins in same PDB: d1lbua1
   complexed with zn

Details for d1lbua2

PDB Entry: 1lbu, 1.8 Å

PDB Description: hydrolase metallo (zn) dd-peptidase

PDB Compounds: (A:) muramoyl-pentapeptide carboxypeptidase

SCOPe Domain Sequences for d1lbua2:

Sequence; same for both SEQRES and ATOM records:

>d1lbua2 d.65.1.1 (A:84-213) Zn2+ DD-carboxypeptidase C-terminal catalytic domain {Streptomyces albus G [TaxId: 1962]}
vnftyaelnrcnsdwsggkvsaataranalvtmwklqamrhamgdkpitvnggfrsvtcn
snvggasnsrhmyghaadlgagsqgfcalaqaarnhgfteilgpgypghndhthvaggdg
rfwsapscgi

Timeline for d1lbua2:

• d1lbua2 first appeared (with stable ids) in SCOP 1.55, called d1lbu_2
  
• d1lbua2 appears in SCOPe 2.07