Lineage for d1lbua1 (1lbu A:1-83)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697917Fold a.20: PGBD-like [47089] (1 superfamily)
    core: 3 helices; bundle, closed, left-handed twist; parallel
  4. 2697918Superfamily a.20.1: PGBD-like [47090] (3 families) (S)
  5. 2697919Family a.20.1.1: Peptidoglycan binding domain, PGBD [47091] (2 proteins)
  6. 2697925Protein Zn2+ DD-carboxypeptidase, N-terminal domain [47092] (1 species)
    probable peptidoglycan-binding domain
  7. 2697926Species Streptomyces albus G [TaxId:1962] [47093] (1 PDB entry)
  8. 2697927Domain d1lbua1: 1lbu A:1-83 [16416]
    Other proteins in same PDB: d1lbua2
    complexed with zn

Details for d1lbua1

PDB Entry: 1lbu (more details), 1.8 Å

PDB Description: hydrolase metallo (zn) dd-peptidase
PDB Compounds: (A:) muramoyl-pentapeptide carboxypeptidase

SCOPe Domain Sequences for d1lbua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lbua1 a.20.1.1 (A:1-83) Zn2+ DD-carboxypeptidase, N-terminal domain {Streptomyces albus G [TaxId: 1962]}
dgcytwsgtlsegssgeavrqlqirvagypgtgaqlaidgqfgpatkaavqrfqsaygla
adgiagpatfnkiyqlqdddctp

SCOPe Domain Coordinates for d1lbua1:

Click to download the PDB-style file with coordinates for d1lbua1.
(The format of our PDB-style files is described here.)

Timeline for d1lbua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lbua2