Lineage for d6lova_ (6lov A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2605913Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2605914Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2606292Family d.165.1.0: automated matches [191615] (1 protein)
    not a true family
  6. 2606293Protein automated matches [191124] (8 species)
    not a true protein
  7. 2606294Species Bitter gourd (Momordica charantia) [TaxId:3673] [312311] (16 PDB entries)
  8. 2606298Domain d6lova_: 6lov A: [395268]
    automated match to d1cf5a_
    protein/RNA complex; complexed with 4uo

Details for d6lova_

PDB Entry: 6lov (more details), 1.35 Å

PDB Description: crystal structure of alpha-momorcharin in complex with xanthosine
PDB Compounds: (A:) Ribosome-inactivating protein momordin I

SCOPe Domain Sequences for d6lova_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6lova_ d.165.1.0 (A:) automated matches {Bitter gourd (Momordica charantia) [TaxId: 3673]}
dvsfrlsgadprsygmfikdlrnalpfrekvyniplllpsvsgagryllmhlfnydgkti
tvavdvtnvyimgyladttsyffnepaaelasqyvfrdarrkitlpysgnyerlqiaagk
prekipiglpaldsaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pslatislenswsglskqiqlaqgnngifrtpivlvdnkgnrvqitnvtskvvtsniqll
lntr

SCOPe Domain Coordinates for d6lova_:

Click to download the PDB-style file with coordinates for d6lova_.
(The format of our PDB-style files is described here.)

Timeline for d6lova_: