SCOPe 2.08: Domain d6lmya1: 6lmy A:1-154

Lineage for d6lmya1 (6lmy A:1-154)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.0: automated matches [191381] (1 protein)
   not a true family

6. Protein automated matches [190475] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187400] (140 PDB entries)

8. Domain d6lmya1: 6lmy A:1-154 [395216]
   Other proteins in same PDB: d6lmya2
   automated match to d1yz4b_
   complexed with po4; mutant

Details for d6lmya1

PDB Entry: 6lmy, 1.5 Å

PDB Description: crystal structure of dusp22 mutant_c88s/s93a

PDB Compounds: (A:) Dual specificity protein phosphatase 22

SCOPe Domain Sequences for d6lmya1:

Sequence; same for both SEQRES and ATOM records:

>d6lmya1 c.45.1.0 (A:1-154) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgngmnkilpglyignfkdardaeqlsknkvthilsvhdsarpmlegvkylcipaadsps
qnltrhfkesikfihecrlrgesclvhslagvarsvtlviayimtvtdfgwedalhtvra
grscanpnvgfqrqlqefekhevhqyrqwlkeey

Timeline for d6lmya1:

• d6lmya1 first appeared in SCOPe 2.07