SCOP 1.57: Domain d1aop_2: 1aop 346-425

Lineage for d1aop_2 (1aop 346-425)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.58: Ferredoxin-like [54861] (36 superfamilies)

4. Superfamily d.58.36: Sulfite reductase, domains 1 and 3 [55124] (1 family)

5. Family d.58.36.1: Sulfite reductase, domains 1 and 3 [55125] (1 protein)

6. Protein Sulfite reductase, domains 1 and 3 [55126] (1 species)

7. Species Escherichia coli [TaxId:562] [55127] (12 PDB entries)

8. Domain d1aop_2: 1aop 346-425 [39502]
   Other proteins in same PDB: d1aop_3, d1aop_4

Details for d1aop_2

PDB Entry: 1aop, 1.6 Å

PDB Description: sulfite reductase structure at 1.6 angstrom resolution

SCOP Domain Sequences for d1aop_2:

Sequence; same for both SEQRES and ATOM records:

>d1aop_2 d.58.36.1 (346-425) Sulfite reductase, domains 1 and 3 {Escherichia coli}
igwvkgiddnwhltlfiengrildyparplktglleiakihkgdfritanqnliiagvpe
sekakiekiakesglmnavt

Timeline for d1aop_2:

• d1aop_2 first appeared (with stable ids) in SCOP 1.55
  
• d1aop_2 appears in SCOP 1.59
  
• d1aop_2 appears in the current release, SCOPe 2.08, called d1aopa2