Lineage for d1aop_2 (1aop 346-425)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 33189Superfamily d.58.36: Sulfite reductase, domains 1 and 3 [55124] (1 family) (S)
  5. 33190Family d.58.36.1: Sulfite reductase, domains 1 and 3 [55125] (1 protein)
  6. 33191Protein Sulfite reductase, domains 1 and 3 [55126] (1 species)
  7. 33192Species Escherichia coli [TaxId:562] [55127] (12 PDB entries)
  8. 33194Domain d1aop_2: 1aop 346-425 [39502]
    Other proteins in same PDB: d1aop_3, d1aop_4

Details for d1aop_2

PDB Entry: 1aop (more details), 1.6 Å

PDB Description: sulfite reductase structure at 1.6 angstrom resolution

SCOP Domain Sequences for d1aop_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aop_2 d.58.36.1 (346-425) Sulfite reductase, domains 1 and 3 {Escherichia coli}
igwvkgiddnwhltlfiengrildyparplktglleiakihkgdfritanqnliiagvpe
sekakiekiakesglmnavt

SCOP Domain Coordinates for d1aop_2:

Click to download the PDB-style file with coordinates for d1aop_2.
(The format of our PDB-style files is described here.)

Timeline for d1aop_2: