Lineage for d7k7db2 (7k7d B:200-380)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2626588Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2626604Superfamily f.1.2: Diphtheria toxin, middle domain [56845] (2 families) (S)
    automatically mapped to Pfam PF02764
  5. 2626619Family f.1.2.0: automated matches [254320] (1 protein)
    not a true family
  6. 2626620Protein automated matches [254734] (1 species)
    not a true protein
  7. 2626621Species Corynebacterium diphtheriae [TaxId:1717] [256177] (7 PDB entries)
  8. 2626628Domain d7k7db2: 7k7d B:200-380 [394888]
    Other proteins in same PDB: d7k7da1, d7k7da3, d7k7da4, d7k7db1, d7k7db3, d7k7db4
    automated match to d1ddta3

Details for d7k7db2

PDB Entry: 7k7d (more details), 2.1 Å

PDB Description: crystal structure of diphtheria toxin from crystals obtained at ph 6.0
PDB Compounds: (B:) diphtheria toxin

SCOPe Domain Sequences for d7k7db2:

Sequence, based on SEQRES records: (download)

>d7k7db2 f.1.2.0 (B:200-380) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
scinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtalehpe
lselktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiadg
avhhnteeivaqsialsslmvaqaiplvgelvdigfaaynfvesiinlfqvvhnsynrpa
y

Sequence, based on observed residues (ATOM records): (download)

>d7k7db2 f.1.2.0 (B:200-380) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
scinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtalehpe
lselktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiadg
avhhnteeivaqsialsslmvaqaiplvgelvgfaaynfvesiinlfqvvhnsynrpay

SCOPe Domain Coordinates for d7k7db2:

Click to download the PDB-style file with coordinates for d7k7db2.
(The format of our PDB-style files is described here.)

Timeline for d7k7db2: