![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
![]() | Superfamily f.1.2: Diphtheria toxin, middle domain [56845] (2 families) ![]() automatically mapped to Pfam PF02764 |
![]() | Family f.1.2.0: automated matches [254320] (1 protein) not a true family |
![]() | Protein automated matches [254734] (1 species) not a true protein |
![]() | Species Corynebacterium diphtheriae [TaxId:1717] [256177] (7 PDB entries) |
![]() | Domain d7k7db2: 7k7d B:200-380 [394888] Other proteins in same PDB: d7k7da1, d7k7da3, d7k7da4, d7k7db1, d7k7db3, d7k7db4 automated match to d1ddta3 |
PDB Entry: 7k7d (more details), 2.1 Å
SCOPe Domain Sequences for d7k7db2:
Sequence, based on SEQRES records: (download)
>d7k7db2 f.1.2.0 (B:200-380) automated matches {Corynebacterium diphtheriae [TaxId: 1717]} scinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtalehpe lselktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiadg avhhnteeivaqsialsslmvaqaiplvgelvdigfaaynfvesiinlfqvvhnsynrpa y
>d7k7db2 f.1.2.0 (B:200-380) automated matches {Corynebacterium diphtheriae [TaxId: 1717]} scinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtalehpe lselktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiadg avhhnteeivaqsialsslmvaqaiplvgelvgfaaynfvesiinlfqvvhnsynrpay
Timeline for d7k7db2:
![]() Domains from other chains: (mouse over for more information) d7k7da1, d7k7da2, d7k7da3, d7k7da4 |