Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) has a circularly permuted topology |
Family d.142.2.0: automated matches [227263] (1 protein) not a true family |
Protein automated matches [227054] (5 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [388491] (8 PDB entries) |
Domain d7k72b_: 7k72 B: [394842] automated match to d1zaua_ complexed with ca, mg, mpd, nad |
PDB Entry: 7k72 (more details), 2.05 Å
SCOPe Domain Sequences for d7k72b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7k72b_ d.142.2.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} apevlrqwqalaeevrehqfryyvrdapiisdaefdellrrlealeeqhpelrtpdsptq lvggagfatdfepvdhlermlsldnaftadelaawagrihaevgdaahylcelkidgval slvyregrltrastrgdgrtgedvtlnartiadvperltpgddypvpevlevrgevffrl ddfqalnaslveegkapfanprnsaagslrqkdpavtarrrlrmichglghvegfrpatl hqaylalrawglpvsehttlatdlagvreridywgehrhevdheidgvvvkvdevalqrr lgstsraprwaiaykyp
Timeline for d7k72b_: