Lineage for d7k72b_ (7k72 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2979301Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) (S)
    has a circularly permuted topology
  5. 2979381Family d.142.2.0: automated matches [227263] (1 protein)
    not a true family
  6. 2979382Protein automated matches [227054] (5 species)
    not a true protein
  7. 2979396Species Mycobacterium tuberculosis [TaxId:83332] [388491] (8 PDB entries)
  8. 2979398Domain d7k72b_: 7k72 B: [394842]
    automated match to d1zaua_
    complexed with ca, mg, mpd, nad

Details for d7k72b_

PDB Entry: 7k72 (more details), 2.05 Å

PDB Description: structure of dna ligase a from mycobacterium tuberculosis bound to nad
PDB Compounds: (B:) DNA ligase A

SCOPe Domain Sequences for d7k72b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7k72b_ d.142.2.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
apevlrqwqalaeevrehqfryyvrdapiisdaefdellrrlealeeqhpelrtpdsptq
lvggagfatdfepvdhlermlsldnaftadelaawagrihaevgdaahylcelkidgval
slvyregrltrastrgdgrtgedvtlnartiadvperltpgddypvpevlevrgevffrl
ddfqalnaslveegkapfanprnsaagslrqkdpavtarrrlrmichglghvegfrpatl
hqaylalrawglpvsehttlatdlagvreridywgehrhevdheidgvvvkvdevalqrr
lgstsraprwaiaykyp

SCOPe Domain Coordinates for d7k72b_:

Click to download the PDB-style file with coordinates for d7k72b_.
(The format of our PDB-style files is described here.)

Timeline for d7k72b_: