SCOPe 2.08: Domain d7k7za1: 7k7z A:30-185

Lineage for d7k7za1 (7k7z A:30-185)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families)

5. Family a.91.1.0: automated matches [191379] (1 protein)
   not a true family

6. Protein automated matches [190464] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187381] (38 PDB entries)

8. Domain d7k7za1: 7k7z A:30-185 [394819]
   Other proteins in same PDB: d7k7za2, d7k7za3, d7k7zb_, d7k7zg_
   automated match to d3v5wa1
   complexed with w4g

Details for d7k7za1

PDB Entry: 7k7z, 2.61 Å

PDB Description: structure of a hit for g protein coupled receptor kinase 2 (grk2) inhibitor for the potential treatment of heart failure

PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d7k7za1:

Sequence; same for both SEQRES and ATOM records:

>d7k7za1 a.91.1.0 (A:30-185) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkillpepsirsvmqkyledrgevtfekifsqklgyllfrdfclnhleearplvefyeei
kkyekleteeervarsreifdsyimkellacshpfsksatehvqghlgkkqvppdlfqpy
ieeicqnlrgdvfqkfiesdkftrfcqwknvelnih

Timeline for d7k7za1:

• d7k7za1 first appeared in SCOPe 2.07