Lineage for d1e8fb1 (1e8f B:274-560)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 505428Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (4 families) (S)
    duplication: contains two subdomains of this fold
  5. 505429Family d.58.32.1: Vanillyl-alcohol oxidase-like [55104] (2 proteins)
  6. 505436Protein Vanillyl-alcohol oxidase [55105] (1 species)
  7. 505437Species Fungus (Penicillium simplicissimum) [TaxId:69488] [55106] (16 PDB entries)
  8. 505467Domain d1e8fb1: 1e8f B:274-560 [39476]
    Other proteins in same PDB: d1e8fa2, d1e8fb2

Details for d1e8fb1

PDB Entry: 1e8f (more details), 2.9 Å

PDB Description: structure of the h61t mutant of the flavoenzyme vanillyl-alcohol oxidase in the apo form

SCOP Domain Sequences for d1e8fb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e8fb1 d.58.32.1 (B:274-560) Vanillyl-alcohol oxidase {Fungus (Penicillium simplicissimum)}
ggyqsylitlpkdgdlkqavdiirplrlgmalqnvptirhilldaavlgdkrsyssrtep
lsdeeldkiakqlnlgrwnfygalygpepirrvlwetikdafsaipgvkfyfpedtpens
vlrvrdktmqgiptydelkwidwlpngahlffspiakvsgedammqyavtkkrcqeagld
figtftvgmremhhivcivfnkkdliqkrkvqwlmrtliddcaangwgeyrthlafmdqi
metynwnnssflrfnevlknavdpngiiapgksgvwpsqyshvtwkl

SCOP Domain Coordinates for d1e8fb1:

Click to download the PDB-style file with coordinates for d1e8fb1.
(The format of our PDB-style files is described here.)

Timeline for d1e8fb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e8fb2