SCOP 1.71: Domain d1e6ve2: 1e6v E:7-189

Lineage for d1e6ve2 (1e6v E:7-189)

Root: SCOP 1.71
Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (2 families)

each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures

Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (2 proteins)
C-terminal domain is all-alpha
Protein Beta chain [55099] (3 species)
Species Archaeon Methanopyrus kandleri [TaxId:2320] [55101] (1 PDB entry)
Domain d1e6ve2: 1e6v E:7-189 [39452]
Other proteins in same PDB: d1e6va1, d1e6va2, d1e6vb1, d1e6vc_, d1e6vd1, d1e6vd2, d1e6ve1, d1e6vf_
complexed with com, f43, tp7

Details for d1e6ve2

PDB Entry: 1e6v (more details), 2.7 Å

PDB Description: methyl-coenzyme m reductase from methanopyrus kandleri

SCOP Domain Sequences for d1e6ve2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6ve2 d.58.31.2 (E:7-189) Beta chain {Archaeon Methanopyrus kandleri}
dtvdlyddrgncvaeevpievlspmrneaiqsivndikrtvavdlegienalqnatvggk
gmkipgremdvdivdnaeaiadeiekmirvyqdddtnvepmydgkrllvqlpservkvma
dpysgtlqagmavvhaiidvcevdmwdanmvkaavfgrypqtidyfggnvasmldvpmkq
egv

SCOP Domain Coordinates for d1e6ve2:

Click to download the PDB-style file with coordinates for d1e6ve2.
(The format of our PDB-style files is described here.)

Timeline for d1e6ve2: