Lineage for d1e6vf_ (1e6v F:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 604877Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (2 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 604878Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (1 protein)
  6. 604879Protein Methyl-coenzyme M reductase gamma chain [55090] (3 species)
  7. 604891Species Archaeon Methanopyrus kandleri [TaxId:2320] [55092] (1 PDB entry)
  8. 604893Domain d1e6vf_: 1e6v F: [39440]
    Other proteins in same PDB: d1e6va1, d1e6va2, d1e6vb1, d1e6vb2, d1e6vd1, d1e6vd2, d1e6ve1, d1e6ve2
    complexed with com, f43, tp7

Details for d1e6vf_

PDB Entry: 1e6v (more details), 2.7 Å

PDB Description: methyl-coenzyme m reductase from methanopyrus kandleri

SCOP Domain Sequences for d1e6vf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6vf_ d.58.31.1 (F:) Methyl-coenzyme M reductase gamma chain {Archaeon Methanopyrus kandleri}
fyypgetdvaenrrkymnpnyelkklreipdedivrlmghrepgeeypsvhppleemeep
ecpirelveptegakagdriryiqftdsvyfapihpyirarmymwryrgvdtgslsgrqi
ievrerdlekiakelleteifdparsgvrgatvhghalrldenglmlhalrryrlneetg
eveyvkdqvgieldepipvgapadeddlkerttiyridgtpyredeellqvvqrihelrt
lagyrpee

SCOP Domain Coordinates for d1e6vf_:

Click to download the PDB-style file with coordinates for d1e6vf_.
(The format of our PDB-style files is described here.)

Timeline for d1e6vf_: