Lineage for d1e6vb2 (1e6v B:7-189)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1207232Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (2 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 1207266Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (2 proteins)
    C-terminal domain is all-alpha
  6. 1207285Protein Beta chain [55099] (3 species)
  7. 1207297Species Methanopyrus kandleri [TaxId:2320] [55101] (1 PDB entry)
  8. 1207298Domain d1e6vb2: 1e6v B:7-189 [39451]
    Other proteins in same PDB: d1e6va1, d1e6va2, d1e6vb1, d1e6vc_, d1e6vd1, d1e6vd2, d1e6ve1, d1e6vf_
    complexed with com, f43, tp7

Details for d1e6vb2

PDB Entry: 1e6v (more details), 2.7 Å

PDB Description: methyl-coenzyme m reductase from methanopyrus kandleri
PDB Compounds: (B:) methyl-coenzyme m reductase I beta subunit

SCOPe Domain Sequences for d1e6vb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6vb2 d.58.31.2 (B:7-189) Beta chain {Methanopyrus kandleri [TaxId: 2320]}
dtvdlyddrgncvaeevpievlspmrneaiqsivndikrtvavdlegienalqnatvggk
gmkipgremdvdivdnaeaiadeiekmirvyqdddtnvepmydgkrllvqlpservkvma
dpysgtlqagmavvhaiidvcevdmwdanmvkaavfgrypqtidyfggnvasmldvpmkq
egv

SCOPe Domain Coordinates for d1e6vb2:

Click to download the PDB-style file with coordinates for d1e6vb2.
(The format of our PDB-style files is described here.)

Timeline for d1e6vb2: