Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (86 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [394417] (2 PDB entries) |
Domain d7c1ja_: 7c1j A: [394424] automated match to d2fspa_ complexed with mg |
PDB Entry: 7c1j (more details), 1.35 Å
SCOPe Domain Sequences for d7c1ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7c1ja_ c.23.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} agqeillvednpvnqtvieamlrslgyrvtlvadgiqavrsaerqrydailmdcrlpvld gysatreiraqengrrvpiialtanalqgdrenclqagmndylakpfkraelqrilqrwi gs
Timeline for d7c1ja_: