Lineage for d7c1ja_ (7c1j A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2856072Species Pseudomonas aeruginosa [TaxId:287] [394417] (2 PDB entries)
  8. 2856074Domain d7c1ja_: 7c1j A: [394424]
    automated match to d2fspa_
    complexed with mg

Details for d7c1ja_

PDB Entry: 7c1j (more details), 1.35 Å

PDB Description: crystal structure of the receiver domain of sensor histidine kinase pa1611 (pa1611rec) from pseudomonas aeruginosa pao1 with magnesium ion coordinated in the active site cleft
PDB Compounds: (A:) Histidine kinase

SCOPe Domain Sequences for d7c1ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7c1ja_ c.23.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
agqeillvednpvnqtvieamlrslgyrvtlvadgiqavrsaerqrydailmdcrlpvld
gysatreiraqengrrvpiialtanalqgdrenclqagmndylakpfkraelqrilqrwi
gs

SCOPe Domain Coordinates for d7c1ja_:

Click to download the PDB-style file with coordinates for d7c1ja_.
(The format of our PDB-style files is described here.)

Timeline for d7c1ja_: