PDB entry 7c1j

View 7c1j on RCSB PDB site
Description: Crystal structure of the receiver domain of sensor histidine kinase PA1611 (PA1611REC) from Pseudomonas aeruginosa PAO1 with magnesium ion coordinated in the active site cleft
Class: transferase
Keywords: P. aeruginosa, Two-component regulatory system, Sensor histidine kinase, Histidine-containing phosphotransfer protein, TRANSFERASE
Deposited on 2020-05-04, released 2020-11-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-11-04, with a file datestamp of 2020-10-30.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histidine kinase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: barA_6, NCTC11839_05765
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7c1ja_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7c1jA (A:)
    mgsshhhhhhssglvpagshmdaapvaagqeillvednpvnqtvieamlrslgyrvtlva
    dgiqavrsaerqrydailmdcrlpvldgysatreiraqengrrvpiialtanalqgdren
    clqagmndylakpfkraelqrilqrwigsqpelpvtsnetgrgepe
    

    Sequence, based on observed residues (ATOM records): (download)
    >7c1jA (A:)
    agqeillvednpvnqtvieamlrslgyrvtlvadgiqavrsaerqrydailmdcrlpvld
    gysatreiraqengrrvpiialtanalqgdrenclqagmndylakpfkraelqrilqrwi
    gs