Lineage for d7ax7a_ (7ax7 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850482Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2850572Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 2850731Family c.6.2.0: automated matches [195981] (1 protein)
    not a true family
  6. 2850732Protein automated matches [195982] (7 species)
    not a true protein
  7. 2850754Species Uncultured bacterium [TaxId:77133] [394381] (1 PDB entry)
  8. 2850755Domain d7ax7a_: 7ax7 A: [394382]
    automated match to d5lgca_
    complexed with act, co

Details for d7ax7a_

PDB Entry: 7ax7 (more details), 2.05 Å

PDB Description: crystal structure of the xyl-ce4 domain of a multidomain xylanase from the hindgut metagenome of trinervitermes trinervoides
PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d7ax7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ax7a_ c.6.2.0 (A:) automated matches {Uncultured bacterium [TaxId: 77133]}
neklialtfddgpssttsdvldilerygvkatffligqnvnsntlsimqrqvrmgcelas
hsythqdmtnmsaqnirnemewtssaiknsvgvdvkffrppyiavnntmyqnidypfiqg
tlindsenstsvqqrvnnalgaakdgqiillhdfqgnsqtvqalpqiieglknqgytfvt
vselfekkgvnpnveykiwsnangq

SCOPe Domain Coordinates for d7ax7a_:

Click to download the PDB-style file with coordinates for d7ax7a_.
(The format of our PDB-style files is described here.)

Timeline for d7ax7a_: