Lineage for d1dy3a_ (1dy3 A:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.58: Ferredoxin-like [54861] (39 superfamilies) 
Superfamily d.58.30: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55083] (1 family) 
Family d.58.30.1: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55084] (1 protein) Protein 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55085] (2 species) Species Escherichia coli [TaxId:562] [55086] (6 PDB entries) 
Domain d1dy3a_: 1dy3 A: [39434]
Details for d1dy3a_
PDB Entry: 1dy3 (more details), 2 Å
PDB Description: ternary complex of 7,8-dihydro-6-hydroxymethylpterinpyrophosphokinase from escherichia coli with atp and a substrate analogue.
SCOP Domain Sequences for d1dy3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dy3a_ d.58.30.1 (A:) 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK {Escherichia coli}
tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
etslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmkn
rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw
SCOP Domain Coordinates for d1dy3a_:
Click to download the PDB-style file with coordinates for d1dy3a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dy3a_:
- d1dy3a_ first appeared (with stable ids) in SCOP 1.55
- d1dy3a_ appears in SCOP 1.57
- d1dy3a_ appears in SCOP 1.61
- d1dy3a_ appears in the current release, SCOPe 2.08
View in 3D