Lineage for d7awoa1 (7awo A:4-160)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891861Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2891862Protein automated matches [190891] (38 species)
    not a true protein
  7. 2892144Species Thermus thermophilus [TaxId:274] [335395] (6 PDB entries)
  8. 2892147Domain d7awoa1: 7awo A:4-160 [394323]
    automated match to d2ji4a1
    complexed with adp, so4

Details for d7awoa1

PDB Entry: 7awo (more details), 1.85 Å

PDB Description: crystal structure of the phosphorybosylpyrophosphate synthetase ii from thermus thermophilus at h32 space group
PDB Compounds: (A:) Ribose-phosphate pyrophosphokinase

SCOPe Domain Sequences for d7awoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7awoa1 c.61.1.0 (A:4-160) automated matches {Thermus thermophilus [TaxId: 274]}
pllifsgqsnrplaqaiaealglplgksttlrfandnlfvryeeslregdvfivqsfvpp
vqdhlmellmmvdaakgasaarvtavipyfsyarsdkkdaprisitarliadllqtagad
rvltmtlhspqvhgffkipvdhlsaepvianyfatrv

SCOPe Domain Coordinates for d7awoa1:

Click to download the PDB-style file with coordinates for d7awoa1.
(The format of our PDB-style files is described here.)

Timeline for d7awoa1: