Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
Protein automated matches [190891] (38 species) not a true protein |
Species Thermus thermophilus [TaxId:274] [335395] (6 PDB entries) |
Domain d7awoa1: 7awo A:4-160 [394323] automated match to d2ji4a1 complexed with adp, so4 |
PDB Entry: 7awo (more details), 1.85 Å
SCOPe Domain Sequences for d7awoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7awoa1 c.61.1.0 (A:4-160) automated matches {Thermus thermophilus [TaxId: 274]} pllifsgqsnrplaqaiaealglplgksttlrfandnlfvryeeslregdvfivqsfvpp vqdhlmellmmvdaakgasaarvtavipyfsyarsdkkdaprisitarliadllqtagad rvltmtlhspqvhgffkipvdhlsaepvianyfatrv
Timeline for d7awoa1: