SCOP 1.71: Domain d1cula_: 1cul A:

Lineage for d1cula_ (1cul A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.29: Nucleotide cyclase [55073] (2 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (5 proteins)
   Pfam 00211
   structurally similar to the "palm" domain of DNA/RNA polymerase superfamily

6. Protein Adenylyl cyclase VC1, domain C1a [55077] (1 species)

7. Species Dog (Canis familiaris) [TaxId:9615] [55078] (9 PDB entries)

8. Domain d1cula_: 1cul A: [39417]
   Other proteins in same PDB: d1culb_, d1culc1, d1culc2
   complexed with 103, 3po, cl, fok, gsp, mes, mg; mutant

Details for d1cula_

PDB Entry: 1cul, 2.4 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with 2',5'-dideoxy-adenosine 3'-triphosphate and mg

SCOP Domain Sequences for d1cula_:

Sequence; same for both SEQRES and ATOM records:

>d1cula_ d.58.29.1 (A:) Adenylyl cyclase VC1, domain C1a {Dog (Canis familiaris)}
mmfhkiyiqkhdnvsilfadiegftslasqctaqelvmtlnelfarfdklaaenhclrik
ilgdcyycvsglpearadhahccvemgmdmieaislvremtgvnvnmrvgihsgrvhcgv
lglrkwqfdvwsndvtlanhmeaggkagrihitkatlsylngdyevepgcggernaylke
hsietflil

Timeline for d1cula_:

• d1cula_ first appeared (with stable ids) in SCOP 1.55
  
• d1cula_ appears in SCOP 1.69
  
• d1cula_ appears in SCOP 1.73
  
• d1cula_ appears in the current release, SCOPe 2.08