Lineage for d1ab8b_ (1ab8 B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1654451Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. 1654452Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins)
    Pfam PF00211
    structurally similar to the "palm" domain of DNA/RNA polymerase superfamily
  6. 1654501Protein Type II adenylyl cyclase C2 domain [55075] (1 species)
  7. 1654502Species Norway rat (Rattus norvegicus) [TaxId:10116] [55076] (9 PDB entries)
    Uniprot P26769 879-1077
  8. 1654504Domain d1ab8b_: 1ab8 B: [39415]
    complexed with fok

Details for d1ab8b_

PDB Entry: 1ab8 (more details), 2.2 Å

PDB Description: rat type ii adenylyl cyclase c2 domain/forskolin complex
PDB Compounds: (B:) adenylyl cyclase

SCOPe Domain Sequences for d1ab8b_:

Sequence, based on SEQRES records: (download)

>d1ab8b_ d.58.29.1 (B:) Type II adenylyl cyclase C2 domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eelyhqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgv
ekiktigstymaatglsaipsqehaqeperqymhigtmvefayalvgkldainkhsfndf
klrvginhgpviagvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgy
tctcrgiinvkgkgdlktyfvn

Sequence, based on observed residues (ATOM records): (download)

>d1ab8b_ d.58.29.1 (B:) Type II adenylyl cyclase C2 domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eelyhqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgv
ekiktigstymaatglsqymhigtmvefayalvgkldainkhsfndfklrvginhgpvia
gvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctctyfvn

SCOPe Domain Coordinates for d1ab8b_:

Click to download the PDB-style file with coordinates for d1ab8b_.
(The format of our PDB-style files is described here.)

Timeline for d1ab8b_: