SCOPe 2.02: Domain d1fvaa_: 1fva A:

Lineage for d1fvaa_ (1fva A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.28: Peptide methionine sulfoxide reductase [55068] (1 family)
   common fold is elaborated with additional secondary structures

5. Family d.58.28.1: Peptide methionine sulfoxide reductase [55069] (2 proteins)

6. Protein Peptide methionine sulfoxide reductase [55070] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [55071] (2 PDB entries)

8. Domain d1fvaa_: 1fva A: [39409]

Details for d1fvaa_

PDB Entry: 1fva, 1.7 Å

PDB Description: crystal structure of bovine methionine sulfoxide reductase

PDB Compounds: (A:) peptide methionine sulfoxide reductase

SCOPe Domain Sequences for d1fvaa_:

Sequence; same for both SEQRES and ATOM records:

>d1fvaa_ d.58.28.1 (A:) Peptide methionine sulfoxide reductase {Cow (Bos taurus) [TaxId: 9913]}
vspqealpgrkeplvvaakhhvngnrtvepfpegtqmavfgmgcfwgaerkfwtlkgvys
tqvgfaggytpnptykevcsgktghaevvrvvfqpehisfeellkvfwenhdptqgmrqg
ndhgsqyrsaiyptsaehvgaalkskedyqkvlsehgfglittdiregqtfyyaedyhqq
ylskdpdgycglggtgvscp

Timeline for d1fvaa_:

• d1fvaa_ first appeared (with stable ids) in SCOP 1.55
  
• d1fvaa_ appears in SCOPe 2.01
  
• d1fvaa_ appears in SCOPe 2.03
  
• d1fvaa_ appears in the current release, SCOPe 2.08