Lineage for d1fwlb2 (1fwl B:168-300)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families) 
common fold is elaborated with additional secondary structures
Family d.58.26.1: Homoserine kinase [55061] (1 protein) Protein Homoserine kinase [55062] (1 species) Species Methanococcus jannaschii [TaxId:2190] [55063] (5 PDB entries) 
Domain d1fwlb2: 1fwl B:168-300 [39403]
Other proteins in same PDB: d1fwla1, d1fwlb1, d1fwlc1, d1fwld1
Details for d1fwlb2
PDB Entry: 1fwl (more details), 2.25 Å
PDB Description: crystal structure of homoserine kinase
PDB Compounds: (B:) homoserine kinaseSCOPe Domain Sequences for d1fwlb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fwlb2 d.58.26.1 (B:168-300) Homoserine kinase {Methanococcus jannaschii [TaxId: 2190]}
fkldiliaipnisintkeareilpkavglkdlvnnvgkacgmvyalynkdkslfgrymms
dkviepvrgklipnyfkikeevkdkvygitisgsgpsiiafpkeefidevenilrdyyen
tirtevgkgvevv
SCOPe Domain Coordinates for d1fwlb2:
Click to download the PDB-style file with coordinates for d1fwlb2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fwlb2:
View in 3D
