Lineage for d1fwkb2 (1fwk B:168-300)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2197530Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2197531Family d.58.26.1: Homoserine kinase [55061] (1 protein)
  6. 2197532Protein Homoserine kinase [55062] (1 species)
  7. 2197533Species Methanococcus jannaschii [TaxId:2190] [55063] (5 PDB entries)
  8. 2197541Domain d1fwkb2: 1fwk B:168-300 [39399]
    Other proteins in same PDB: d1fwka1, d1fwkb1, d1fwkc1, d1fwkd1
    CASP4
    complexed with adp, mg

Details for d1fwkb2

PDB Entry: 1fwk (more details), 2.1 Å

PDB Description: crystal structure of homoserine kinase complexed with adp
PDB Compounds: (B:) homoserine kinase

SCOPe Domain Sequences for d1fwkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fwkb2 d.58.26.1 (B:168-300) Homoserine kinase {Methanococcus jannaschii [TaxId: 2190]}
fkldiliaipnisintkeareilpkavglkdlvnnvgkacgmvyalynkdkslfgrymms
dkviepvrgklipnyfkikeevkdkvygitisgsgpsiiafpkeefidevenilrdyyen
tirtevgkgvevv

SCOPe Domain Coordinates for d1fwkb2:

Click to download the PDB-style file with coordinates for d1fwkb2.
(The format of our PDB-style files is described here.)

Timeline for d1fwkb2: