![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
![]() | Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (7 proteins) |
![]() | Protein automated matches [232306] (2 species) not a true protein |
![]() | Species Homo sapiens [TaxId:9606] [362871] (13 PDB entries) |
![]() | Domain d6zgye1: 6zgy E:2-216 [393981] Other proteins in same PDB: d6zgya2, d6zgyb2, d6zgyd2, d6zgye2 automated match to d1wuua1 complexed with gal, hfk, ql5 |
PDB Entry: 6zgy (more details), 2.3 Å
SCOPe Domain Sequences for d6zgye1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zgye1 d.14.1.5 (E:2-216) automated matches {Homo sapiens [TaxId: 9606]} aalrqpqvaellaearrafreefgaepelavsapgrvnligehtdynqglvlpmalelmt vlvgsprkdglvsllttsegadepqrlqfplptaqrslepgtprwanyvkgviqyypaap lpgfsavvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqaehsfagmp cgimdqfislmgqkghallidcrsletslvplsdp
Timeline for d6zgye1: