Lineage for d6z9gc_ (6z9g C:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3019032Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 3019033Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 3019034Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins)
  6. 3019069Protein automated matches [190110] (7 species)
    not a true protein
  7. 3019149Species Desulfovibrio vulgaris [TaxId:882] [197352] (21 PDB entries)
  8. 3019166Domain d6z9gc_: 6z9g C: [393881]
    Other proteins in same PDB: d6z9gb_, d6z9gd_, d6z9gf_, d6z9gh_
    automated match to d5jska_
    complexed with 6ml, cl, fco, fe2, h2s, ni, sf4

Details for d6z9gc_

PDB Entry: 6z9g (more details), 1.76 Å

PDB Description: structure of [nifese] hydrogenase g491a variant from desulfovibrio vulgaris hildenborough pressurized with oxygen gas - structure g491a- o2
PDB Compounds: (C:) periplasmic [nifese] hydrogenase, small subunit

SCOPe Domain Sequences for d6z9gc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6z9gc_ e.19.1.1 (C:) automated matches {Desulfovibrio vulgaris [TaxId: 882]}
rppvfwlqgqgctgcsvtllnsvhpsiadvllkvislefhptvmawegehaiehmrkvae
kfkgkfflviegsvpveadgkyciigeanhheismvdalkefgpnaaavlavgtcaaygg
ipaaegsetgatavskflgdngiktpvvnipgcpphpdwivgtvvlaldaikkngleggl
aevvkvldsdgrptpffgrnihencpyldkydegvmsatftdkvgcrydlgckgpmtmad
cferkwnggvnwcvqnavcigcvepdfpdgkspfyqa

SCOPe Domain Coordinates for d6z9gc_:

Click to download the PDB-style file with coordinates for d6z9gc_.
(The format of our PDB-style files is described here.)

Timeline for d6z9gc_: