Lineage for d6ydib_ (6ydi B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2316569Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2316867Protein automated matches [190435] (12 species)
    not a true protein
  7. 2316962Species Methylosinus trichosporium [TaxId:595536] [392644] (9 PDB entries)
  8. 2316969Domain d6ydib_: 6ydi B: [393675]
    Other proteins in same PDB: d6ydif_, d6ydig_
    automated match to d1mtyb_
    complexed with fe2, gol

Details for d6ydib_

PDB Entry: 6ydi (more details), 1.95 Å

PDB Description: xfel structure of the soluble methane monooxygenase hydroxylase and regulatory subunit complex, from methylosinus trichosporium ob3b, diferrous state
PDB Compounds: (B:) Methane monooxygenase

SCOPe Domain Sequences for d6ydib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ydib_ a.25.1.2 (B:) automated matches {Methylosinus trichosporium [TaxId: 595536]}
qssqvtkrgltdperaaiiaaavpdhaldtqrkyhyfiqprwkrlseyeqlscyaqpnpd
wiaggldwgdwtqkfhggrpswgnestelrttdwyrhrdparrwhhpyvkdkseearytq
rflaayssegsirtidpywrdeilnkyfgallyseyglfnahssvgrdclsdtirqtavf
aaldkvdnaqmiqmerlfiaklvpgfdastdvpkkiwttdpiysgaratvqeiwqgvqdw
neilwaghavydatfgqfarreffqrlatvygdtltpfftaqsqtyfqttrgaiddlfvy
clandsefgahnrtflnawtehylassvaalkdfvglyakvekvagatdragvsealqrv
fgdwkidyadkigfrvdvdqkvdavlagy

SCOPe Domain Coordinates for d6ydib_:

Click to download the PDB-style file with coordinates for d6ydib_.
(The format of our PDB-style files is described here.)

Timeline for d6ydib_: