SCOPe 2.08: Domain d6y6db1: 6y6d B:2-245

Lineage for d6y6db1 (6y6d B:2-245)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (9 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226564] (136 PDB entries)

8. Domain d6y6db1: 6y6d B:2-245 [393591]
   Other proteins in same PDB: d6y6da2, d6y6db2, d6y6dc2, d6y6dd2, d6y6de_, d6y6df1, d6y6df2
   automated match to d4drxb1
   complexed with acp, ca, gdp, gol, gtp, mes, mg, obq

Details for d6y6db1

PDB Entry: 6y6d, 2.2 Å

PDB Description: tubulin-7-aminonoscapine complex

PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d6y6db1:

Sequence; same for both SEQRES and ATOM records:

>d6y6db1 c.32.1.1 (B:2-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

Timeline for d6y6db1:

• d6y6db1 first appeared in SCOPe 2.07