Lineage for d6y6de_ (6y6d E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733644Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2733915Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2733916Family a.137.10.1: Stathmin [101495] (2 proteins)
  6. 2733917Protein Stathmin 4 [101496] (3 species)
  7. 2733934Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries)
  8. 2733950Domain d6y6de_: 6y6d E: [393588]
    Other proteins in same PDB: d6y6da1, d6y6da2, d6y6db1, d6y6db2, d6y6dc1, d6y6dc2, d6y6dd1, d6y6dd2, d6y6df1, d6y6df2
    automated match to d4i55e_
    complexed with acp, ca, gdp, gol, gtp, mes, mg, obq

Details for d6y6de_

PDB Entry: 6y6d (more details), 2.2 Å

PDB Description: tubulin-7-aminonoscapine complex
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d6y6de_:

Sequence, based on SEQRES records: (download)

>d6y6de_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelkeea

Sequence, based on observed residues (ATOM records): (download)

>d6y6de_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppdpsleeiqkkleaaeerrkyqeaellkhlaekrehere
viqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelke
ea

SCOPe Domain Coordinates for d6y6de_:

Click to download the PDB-style file with coordinates for d6y6de_.
(The format of our PDB-style files is described here.)

Timeline for d6y6de_: