Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries) |
Domain d6y09a_: 6y09 A: [393538] automated match to d3tw8b_ complexed with edo, gtp, mg, peg, po4 |
PDB Entry: 6y09 (more details), 2.4 Å
SCOPe Domain Sequences for d6y09a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6y09a_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rsrifkiivigdsnvgktcltyrfcagrfpdrteatigvdfreraveidgerikiqlwdt aglerfrksmvqhyyrnvhavvfvydmtnmasfhslpswieeckqhllandiprilvgnk cdlrsaiqvptdlaqkfadthsmplfetsaknpndndhveaifmtlahklkshkpl
Timeline for d6y09a_: