SCOPe 2.08: Domain d6y09a_: 6y09 A:

Lineage for d6y09a_ (6y09 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries)

8. Domain d6y09a_: 6y09 A: [393538]
   automated match to d3tw8b_
   complexed with edo, gtp, mg, peg, po4

Details for d6y09a_

PDB Entry: 6y09, 2.4 Å

PDB Description: crystal structure of atg16l in complex with gtp-bound rab33b (q92l)

PDB Compounds: (A:) Ras-related protein Rab-33B

SCOPe Domain Sequences for d6y09a_:

Sequence; same for both SEQRES and ATOM records:

>d6y09a_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rsrifkiivigdsnvgktcltyrfcagrfpdrteatigvdfreraveidgerikiqlwdt
aglerfrksmvqhyyrnvhavvfvydmtnmasfhslpswieeckqhllandiprilvgnk
cdlrsaiqvptdlaqkfadthsmplfetsaknpndndhveaifmtlahklkshkpl

Timeline for d6y09a_:

• d6y09a_ first appeared in SCOPe 2.07