SCOPe 2.03: Domain d1feea_: 1fee A:

Lineage for d1feea_ (1fee A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families)

5. Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)

6. Protein ATX1 metallochaperone protein (ATOX1) [55014] (2 species)

7. Species Human (Homo sapiens), HAH1 [TaxId:9606] [55016] (8 PDB entries)
   Uniprot O00244

8. Domain d1feea_: 1fee A: [39349]
   complexed with cu1, so4, suc

Details for d1feea_

PDB Entry: 1fee, 1.8 Å

PDB Description: crystal structure of copper-hah1

PDB Compounds: (A:) copper transport protein atox1

SCOPe Domain Sequences for d1feea_:

Sequence; same for both SEQRES and ATOM records:

>d1feea_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]}
pkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgkt
vsylgle

Timeline for d1feea_:

• d1feea_ first appeared (with stable ids) in SCOP 1.55
  
• d1feea_ appears in SCOPe 2.02
  
• d1feea_ appears in SCOPe 2.04
  
• d1feea_ appears in the current release, SCOPe 2.08