Lineage for d1fe0b_ (1fe0 B:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.58: Ferredoxin-like [54861] (40 superfamilies) 
Superfamily d.58.17: Metal-binding domain [55008] (1 family) 
Family d.58.17.1: Metal-binding domain [55009] (7 proteins) Protein ATX1 metallochaperone protein (ATOX1) [55014] (2 species) 
Species Human (Homo sapiens), HAH1 [TaxId:9606] [55016] (3 PDB entries) 
Domain d1fe0b_: 1fe0 B: [39346]
Details for d1fe0b_
PDB Entry: 1fe0 (more details), 1.75 Å
PDB Description: crystal structure of cadmium-hah1
SCOP Domain Sequences for d1fe0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fe0b_ d.58.17.1 (B:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1}
mpkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgk
tvsylgle
SCOP Domain Coordinates for d1fe0b_:
Click to download the PDB-style file with coordinates for d1fe0b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fe0b_:
- d1fe0b_ first appeared (with stable ids) in SCOP 1.55
- d1fe0b_ appears in SCOP 1.59
- d1fe0b_ appears in SCOP 1.63
- d1fe0b_ appears in the current release, SCOPe 2.08
View in 3D
