Lineage for d6xsva1 (6xsv A:1-381)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2438501Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2439016Protein automated matches [190099] (33 species)
    not a true protein
  7. 2439017Species Aspergillus oryzae [TaxId:5062] [393398] (1 PDB entry)
  8. 2439018Domain d6xsva1: 6xsv A:1-381 [393399]
    Other proteins in same PDB: d6xsva2
    automated match to d2taaa2
    complexed with ca, man, mes, nag, plm

Details for d6xsva1

PDB Entry: 6xsv (more details), 1.65 Å

PDB Description: x-ray structure of a tetragonal crystal form of alpha amylase from aspergillus oryzae (tala-amylase) at 1.65 a resolution
PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d6xsva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xsva1 c.1.8.1 (A:1-381) automated matches {Aspergillus oryzae [TaxId: 5062]}
atpadwrsqsiyflltdrfartdgsttatcntadqkycggtwqgiidkldyiqgmgftai
witpvtaqlpqttaygdayhgywqqdiyslnenygtaddlkalssalhergmylmvdvva
nhmgydgagssvdysvfkpfssqdyfhpfcliqnyedqtqvedcwlgdntvslpdldttk
dvvknewydwvgslvsnysidglridtvkhvqkdfwpgynkaagvycigevldgdpaytc
pyqnvmdgvlnypiyypllnafkstsgsmddlynmintvksdcpdstllgtfvenhdnpr
fasytndialaknvaafiilndgipiiyagqeqhyaggndpanreatwlsgyptdselyk
liasanairnyaiskdtgfvt

SCOPe Domain Coordinates for d6xsva1:

Click to download the PDB-style file with coordinates for d6xsva1.
(The format of our PDB-style files is described here.)

Timeline for d6xsva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6xsva2