Lineage for d6xrma3 (6xrm A:543-725)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2338495Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2338713Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein)
    automatically mapped to Pfam PF00613
    this is a repeat family; one repeat unit is 1e8y A:598-635 found in domain
  6. 2338714Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species)
  7. 2338715Species Human (Homo sapiens) [TaxId:9606] [48402] (77 PDB entries)
  8. 2338745Domain d6xrma3: 6xrm A:543-725 [393392]
    Other proteins in same PDB: d6xrma1, d6xrma2, d6xrma4
    automated match to d1e8ya1
    complexed with so4, v81

Details for d6xrma3

PDB Entry: 6xrm (more details), 2.88 Å

PDB Description: crystal structure of human pi3k-gamma in complex with compound 4
PDB Compounds: (A:) Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d6xrma3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xrma3 a.118.1.6 (A:543-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
vraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqe
ivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllq
lvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylr
gcg

SCOPe Domain Coordinates for d6xrma3:

Click to download the PDB-style file with coordinates for d6xrma3.
(The format of our PDB-style files is described here.)

Timeline for d6xrma3: