| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (27 families) ![]() |
| Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein) automatically mapped to Pfam PF00613 this is a repeat family; one repeat unit is 1e8y A:598-635 found in domain |
| Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [48402] (77 PDB entries) |
| Domain d6xrma3: 6xrm A:543-725 [393392] Other proteins in same PDB: d6xrma1, d6xrma2, d6xrma4 automated match to d1e8ya1 complexed with so4, v81 |
PDB Entry: 6xrm (more details), 2.88 Å
SCOPe Domain Sequences for d6xrma3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xrma3 a.118.1.6 (A:543-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
vraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqe
ivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllq
lvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylr
gcg
Timeline for d6xrma3: