Lineage for d6x19n1 (6x19 N:6-126)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2355831Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries)
  8. 2355969Domain d6x19n1: 6x19 N:6-126 [393253]
    Other proteins in same PDB: d6x19b_, d6x19g_, d6x19n2
    automated match to d2vyre_
    complexed with uk1

Details for d6x19n1

PDB Entry: 6x19 (more details), 2.1 Å

PDB Description: non peptide agonist chu-128, bound to glucagon-like peptide-1 (glp-1) receptor
PDB Compounds: (N:) Nanobody35

SCOPe Domain Sequences for d6x19n1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6x19n1 b.1.1.1 (N:6-126) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqpggslrlscaasgftfsnykmnwvrqapgkglewvsdisqsgasisytgsvk
grftisrdnakntlylqmnslkpedtavyycarcpapftrdcfdvtsttyayrgqgtqvt
v

SCOPe Domain Coordinates for d6x19n1:

Click to download the PDB-style file with coordinates for d6x19n1.
(The format of our PDB-style files is described here.)

Timeline for d6x19n1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6x19n2