SCOPe 2.07: Domain d6x1an1: 6x1a N:6-126

Lineage for d6x1an1 (6x1a N:6-126)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries)

8. Domain d6x1an1: 6x1a N:6-126 [393160]
   Other proteins in same PDB: d6x1ab_, d6x1ag_, d6x1an2
   automated match to d2vyre_
   complexed with uk4

Details for d6x1an1

PDB Entry: 6x1a, 2.5 Å

PDB Description: non peptide agonist pf-06882961, bound to glucagon-like peptide-1 (glp-1) receptor

PDB Compounds: (N:) Nanobody35

SCOPe Domain Sequences for d6x1an1:

Sequence; same for both SEQRES and ATOM records:

>d6x1an1 b.1.1.1 (N:6-126) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqpggslrlscaasgftfsnykmnwvrqapgkglewvsdisqsgasisytgsvk
grftisrdnakntlylqmnslkpedtavyycarcpapftrdcfdvtsttyayrgqgtqvt
v

Timeline for d6x1an1:

• d6x1an1 is new in SCOPe 2.07-stable
  
• d6x1an1 appears in the current release, SCOPe 2.08