Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.58: Ferredoxin-like [54861] (49 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) C-terminal domain is beta/alpha barrel |
Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (8 species) |
Species Rhodospirillum rubrum [TaxId:1085] [54974] (5 PDB entries) |
Domain d1rbab2: 1rba B:5-137 [39297] Other proteins in same PDB: d1rbaa1, d1rbab1 |
PDB Entry: 1rba (more details), 2.6 Å
SCOP Domain Sequences for d1rbab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rbab2 d.58.9.1 (B:5-137) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum} sryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtnvevcttddft rgvdalvyevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveyakmh dfyvpeayralfd
Timeline for d1rbab2: