SCOPe 2.08: Domain d6w7sl1: 6w7s L:18-131

Lineage for d6w7sl1 (6w7s L:18-131)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6w7sl1: 6w7s L:18-131 [392926]
   Other proteins in same PDB: d6w7sa1, d6w7sa2, d6w7sl2
   automated match to d2mcg11
   complexed with cl, mes

Details for d6w7sl1

PDB Entry: 6w7s, 2.25 Å

PDB Description: ketoreductase from module 1 of the 6-deoxyerythronolide b synthase (kr1) in complex with antibody fragment (fab) 2g10

PDB Compounds: (L:) 2G10 (Fab light chain)

SCOPe Domain Sequences for d6w7sl1:

Sequence; same for both SEQRES and ATOM records:

>d6w7sl1 b.1.1.0 (L:18-131) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vltqpsslsaspgasasltctlrsginvgtyriywyqqkpgsppqyllryksdsdkqqgs
gvpsrfsgskdasanagillisglqsedeadyycmtwhssayvfgtgtkvtvlg

Timeline for d6w7sl1:

• d6w7sl1 first appeared in SCOPe 2.07