Class b: All beta proteins [48724] (178 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins) |
Protein automated matches [190384] (21 species) not a true protein |
Species Norwalk virus (strain gi/human/united states/norwalk/1968) [TaxId:524364] [311468] (7 PDB entries) |
Domain d6w5kd1: 6w5k D:1-173 [392883] Other proteins in same PDB: d6w5ka2, d6w5kb2, d6w5kc2, d6w5kd2 automated match to d2fyqa_ complexed with tkv |
PDB Entry: 6w5k (more details), 1.95 Å
SCOPe Domain Sequences for d6w5kd1:
Sequence, based on SEQRES records: (download)
>d6w5kd1 b.47.1.4 (D:1-173) automated matches {Norwalk virus (strain gi/human/united states/norwalk/1968) [TaxId: 524364]} apptlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrf skkmrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgm lltganakgmdlgtipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavqa
>d6w5kd1 b.47.1.4 (D:1-173) automated matches {Norwalk virus (strain gi/human/united states/norwalk/1968) [TaxId: 524364]} apptlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrf skkmrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgm lllgtipgdcgapyvhkrwvvcgvhaaatksntvvcavqa
Timeline for d6w5kd1: