SCOPe 2.07: Domain d6w5ja1: 6w5j A:1-173

Lineage for d6w5ja1 (6w5j A:1-173)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein automated matches [190384] (21 species)
   not a true protein

7. Species Norwalk virus (strain gi/human/united states/norwalk/1968) [TaxId:524364] [311468] (7 PDB entries)

8. Domain d6w5ja1: 6w5j A:1-173 [392872]
   Other proteins in same PDB: d6w5ja2
   automated match to d2fyqa_
   complexed with tks

Details for d6w5ja1

PDB Entry: 6w5j, 1.85 Å

PDB Description: 1.85 a resolution structure of norovirus 3cl protease in complex with inhibitor 7d

PDB Compounds: (A:) 3C-like protease

SCOPe Domain Sequences for d6w5ja1:

Sequence, based on SEQRES records:

>d6w5ja1 b.47.1.4 (A:1-173) automated matches {Norwalk virus (strain gi/human/united states/norwalk/1968) [TaxId: 524364]}
apptlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrf
skkmrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgm
lltganakgmdlgtipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavqa

Sequence, based on observed residues (ATOM records):

>d6w5ja1 b.47.1.4 (A:1-173) automated matches {Norwalk virus (strain gi/human/united states/norwalk/1968) [TaxId: 524364]}
apptlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrf
skkmrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgm
llakgmdlgtipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavqa

Timeline for d6w5ja1:

• d6w5ja1 is new in SCOPe 2.07-stable
  
• d6w5ja1 appears in the current release, SCOPe 2.08