Lineage for d1rbla2 (1rbl A:9-147)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191935Fold d.58: Ferredoxin-like [54861] (40 superfamilies)
  4. 192424Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
  5. 192425Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 192426Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (8 species)
  7. 192513Species Synechococcus sp., strain pcc 6301 [TaxId:1131] [54973] (2 PDB entries)
  8. 192514Domain d1rbla2: 1rbl A:9-147 [39286]
    Other proteins in same PDB: d1rbla1, d1rblm_

Details for d1rbla2

PDB Entry: 1rbl (more details), 2.2 Å

PDB Description: structure determination and refinement of ribulose 1,5 bisphosphate carboxylase(slash)oxygenase from synechococcus pcc6301

SCOP Domain Sequences for d1rbla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rbla2 d.58.9.1 (A:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Synechococcus sp., strain pcc 6301}
saagykagvkdykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesstgtwtt
vwtdlltdmdrykgkcyhiepvageensyfafiaypldlfeegsvtniltsivgnvfgfk
airslrledirfpvalvkt

SCOP Domain Coordinates for d1rbla2:

Click to download the PDB-style file with coordinates for d1rbla2.
(The format of our PDB-style files is described here.)

Timeline for d1rbla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rbla1
View in 3D
Domains from other chains:
(mouse over for more information)
d1rblm_