Lineage for d6vk6c_ (6vk6 C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312626Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
    core: 3 helices; bundle, open
  4. 2312673Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) (S)
    duplication: consists of two domains of this fold
    automatically mapped to Pfam PF02964
  5. 2312674Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (2 proteins)
  6. 2312736Protein automated matches [369668] (2 species)
    not a true protein
  7. 2312740Species Methylosinus trichosporium [TaxId:595536] [392672] (9 PDB entries)
  8. 2312741Domain d6vk6c_: 6vk6 C: [392732]
    Other proteins in same PDB: d6vk6a_, d6vk6b_
    automated match to d1mhyg_
    complexed with cl, edo, fe

Details for d6vk6c_

PDB Entry: 6vk6 (more details), 1.52 Å

PDB Description: crystal structure of methylosinus trichosporium ob3b soluble methane monooxygenase hydroxylase
PDB Compounds: (C:) Methane monooxygenase

SCOPe Domain Sequences for d6vk6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vk6c_ a.23.3.1 (C:) automated matches {Methylosinus trichosporium [TaxId: 595536]}
akrepihdnsirteweakiakltsvdqatkfiqdfrlaytspfrksydidvdyqyierki
eeklsvlkteklpvadlitkattgedaaaveatwiakikaakskyeaerihiefrqlykp
pvlpvnvflrtdaalgtvlmeirntdyygtpleglrkergvkvlhlqa

SCOPe Domain Coordinates for d6vk6c_:

Click to download the PDB-style file with coordinates for d6vk6c_.
(The format of our PDB-style files is described here.)

Timeline for d6vk6c_: