Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.1: Cystatin/monellin [54403] (7 families) has a additional strand at the N-terminus |
Family d.17.1.0: automated matches [191407] (1 protein) not a true family |
Protein automated matches [190558] (13 species) not a true protein |
Species Humulus lupulus [TaxId:3486] [392723] (2 PDB entries) |
Domain d6vlqa_: 6vlq A: [392724] automated match to d3imad_ complexed with so4 |
PDB Entry: 6vlq (more details), 1.8 Å
SCOPe Domain Sequences for d6vlqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6vlqa_ d.17.1.0 (A:) automated matches {Humulus lupulus [TaxId: 3486]} ieslaryavdehnkkqnsllqfekvvntkqqvvsgtiyiitleavdggkkkvyeakvwek pwmnfkelqefkligdaps
Timeline for d6vlqa_: