Lineage for d6vlqa_ (6vlq A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2542784Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 2542960Family d.17.1.0: automated matches [191407] (1 protein)
    not a true family
  6. 2542961Protein automated matches [190558] (13 species)
    not a true protein
  7. 2542995Species Humulus lupulus [TaxId:3486] [392723] (2 PDB entries)
  8. 2542997Domain d6vlqa_: 6vlq A: [392724]
    automated match to d3imad_
    complexed with so4

Details for d6vlqa_

PDB Entry: 6vlq (more details), 1.8 Å

PDB Description: hop phytocystatin in space group p22121
PDB Compounds: (A:) Hop1

SCOPe Domain Sequences for d6vlqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vlqa_ d.17.1.0 (A:) automated matches {Humulus lupulus [TaxId: 3486]}
ieslaryavdehnkkqnsllqfekvvntkqqvvsgtiyiitleavdggkkkvyeakvwek
pwmnfkelqefkligdaps

SCOPe Domain Coordinates for d6vlqa_:

Click to download the PDB-style file with coordinates for d6vlqa_.
(The format of our PDB-style files is described here.)

Timeline for d6vlqa_: